(data stored in ACNUC7421 zone)

EMBL: CP000489.PE126

CP000489.PE126       Location/Qualifiers
FT   CDS             115048..115260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68243"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY99"
FT                   /protein_id="ABL68243.1"
FT                   /translation="MNNPNTVTELIAEAANALIRRDPHRLEELERISRGWMQTHDEELA
FT                   QIILLQAMTEAADLLLDTPSEIESA"
     MNNPNTVTEL IAEAANALIR RDPHRLEELE RISRGWMQTH DEELAQIILL QAMTEAADLL        60
     LDTPSEIESA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page