(data stored in ACNUC7421 zone)

EMBL: CP000489.PE127

CP000489.PE127       Location/Qualifiers
FT   CDS             complement(115281..115730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68244"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA0"
FT                   /protein_id="ABL68244.1"
FT                   /translation="MRTSEGLHGIVADAGGDHRLWFPHGMARIRLAIVVPLDEDLMVRL
FT                   NSIQRFHRLLTGRPVRPIPSLQALSASERHRATLMLRAWDGAESGASRRDIAGVLFRTD
FT                   FSGLSAAEWKSASERRQLARILAEARSMVGGEYLTLLRGGQHRRR"
     MRTSEGLHGI VADAGGDHRL WFPHGMARIR LAIVVPLDED LMVRLNSIQR FHRLLTGRPV        60
     RPIPSLQALS ASERHRATLM LRAWDGAESG ASRRDIAGVL FRTDFSGLSA AEWKSASERR       120
     QLARILAEAR SMVGGEYLTL LRGGQHRRR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page