(data stored in ACNUC7421 zone)

EMBL: CP000489.PE13

CP000489.PE13        Location/Qualifiers
FT   CDS             10905..12089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0013"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /note="KEGG: rsp:RSP_1224 coproporphyrinogen III oxidase;
FT                   TIGRFAM: putative oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68130"
FT                   /db_xref="GOA:A1AXY6"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY6"
FT                   /protein_id="ABL68130.1"
FT                   /translation="MPAPAASTAPLAEDWRAGGFGLYVHWPFCAAKCPYCDFNSHVAAA
FT                   IEQGRWLAAYRAEIARLGRETPGRVLNSIFFGGGTPSLMAPETVAGVIEAARAAWPFAN
FT                   DIEITLEANPTSVETGRFRAYADAGVNRVSMGVQALNDDDLRRLGRMHSAGEARAAFDI
FT                   ARDCFTRVSFDLIYARQDQDRAHWRRELGEALGMAVDHLSAYQLTIEPGTAFGARHAKG
FT                   GLKGLPDDDLSADMYLDTQEICAAAGMPTYEISNHARPGAESRHNLIYWRQGDWAAVGP
FT                   GAHGRLTLPSGRWATEAHLAPGAWLEAVEARGNGDSQREMLGLSDRALEYLLMSMRLVE
FT                   GLDVPRYLAHGAELPQDRLMNLAELGLISLRGDRLAATAAGRPVLNAILRELAE"
     MPAPAASTAP LAEDWRAGGF GLYVHWPFCA AKCPYCDFNS HVAAAIEQGR WLAAYRAEIA        60
     RLGRETPGRV LNSIFFGGGT PSLMAPETVA GVIEAARAAW PFANDIEITL EANPTSVETG       120
     RFRAYADAGV NRVSMGVQAL NDDDLRRLGR MHSAGEARAA FDIARDCFTR VSFDLIYARQ       180
     DQDRAHWRRE LGEALGMAVD HLSAYQLTIE PGTAFGARHA KGGLKGLPDD DLSADMYLDT       240
     QEICAAAGMP TYEISNHARP GAESRHNLIY WRQGDWAAVG PGAHGRLTLP SGRWATEAHL       300
     APGAWLEAVE ARGNGDSQRE MLGLSDRALE YLLMSMRLVE GLDVPRYLAH GAELPQDRLM       360
     NLAELGLISL RGDRLAATAA GRPVLNAILR ELAE                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page