(data stored in ACNUC7421 zone)

EMBL: CP000489.PE130

CP000489.PE130       Location/Qualifiers
FT   CDS             complement(116687..116923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0130"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mlo:msr6108 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68247"
FT                   /db_xref="GOA:A1AYA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA3"
FT                   /protein_id="ABL68247.1"
FT                   /translation="MPGDSSGMRLRERVARNLRRLRQEKSLSQEELADRADINRNYVGM
FT                   LEREENAATVDMLEKLAAVLEVDPVELLRRDKD"
     MPGDSSGMRL RERVARNLRR LRQEKSLSQE ELADRADINR NYVGMLEREE NAATVDMLEK        60
     LAAVLEVDPV ELLRRDKD                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page