(data stored in ACNUC7421 zone)

EMBL: CP000489.PE131

CP000489.PE131       Location/Qualifiers
FT   CDS             117115..117384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68248"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA4"
FT                   /protein_id="ABL68248.1"
FT                   /translation="MQNEPDPDWPRFVRTEEAARLLDLSPRTLEKHRCGGTGPVYRKLG
FT                   GRVVYTIADLRAWIEGSARQSTSEMAKIARKPDRTLAEARRAGR"
     MQNEPDPDWP RFVRTEEAAR LLDLSPRTLE KHRCGGTGPV YRKLGGRVVY TIADLRAWIE        60
     GSARQSTSEM AKIARKPDRT LAEARRAGR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page