(data stored in ACNUC7421 zone)

EMBL: CP000489.PE134

CP000489.PE134       Location/Qualifiers
FT   CDS             119003..120622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0134"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase;
FT                   transposase IS116/IS110/IS902 family protein; KEGG:
FT                   mlo:mll5964 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68251"
FT                   /db_xref="GOA:A1AYA7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA7"
FT                   /protein_id="ABL68251.1"
FT                   /translation="MTMPRASLSLPLHVLDLFSGAAGGWSLGLHRAGFMTIAACEIVEW
FT                   RRILYSENFPHVRLYADIRDLTATRLVSDLGCLPDIVVGSPPCQDISSANTKGKGIEGE
FT                   RSGLYLEAVRLVGECRPRWFAFENRSYGCLPEAAVVRLWARQMVKEAAMNTQVHQHKSH
FT                   VIAHDEVSAIFISLELSKSTWLVTSISPGAGEKMSRHTVKGGDVAALMDRFDALRHKAL
FT                   QRTGRDFPIVTIHEAGLDGFWIHRILEREGVESHIVDAASIAVPRRHRRVKTDKVDGET
FT                   LVRTLLAWKRGEPRVCSMVRVPSPEDEDRRRPSRERKVLIAERVSHVNRIKGLLYSQGV
FT                   AYEPLHRNRRQNLEELRTGDGRPLSPCLKRQILRELDRLELLLEQIRNVEAERDADLKE
FT                   ERKTDTPPVGVLAALKGIGPEFAAVIWAEGLSRPFENRRQVAAYAGLAPTPWQSGSVNR
FT                   EQGVSKSGNPRLRTTMIQLAWLWLRHQPRSELSCWFQQRVAGHGGRVRKTMIAAMARKL
FT                   LVALWKYLTAGVVIEGAAMKTV"
     MTMPRASLSL PLHVLDLFSG AAGGWSLGLH RAGFMTIAAC EIVEWRRILY SENFPHVRLY        60
     ADIRDLTATR LVSDLGCLPD IVVGSPPCQD ISSANTKGKG IEGERSGLYL EAVRLVGECR       120
     PRWFAFENRS YGCLPEAAVV RLWARQMVKE AAMNTQVHQH KSHVIAHDEV SAIFISLELS       180
     KSTWLVTSIS PGAGEKMSRH TVKGGDVAAL MDRFDALRHK ALQRTGRDFP IVTIHEAGLD       240
     GFWIHRILER EGVESHIVDA ASIAVPRRHR RVKTDKVDGE TLVRTLLAWK RGEPRVCSMV       300
     RVPSPEDEDR RRPSRERKVL IAERVSHVNR IKGLLYSQGV AYEPLHRNRR QNLEELRTGD       360
     GRPLSPCLKR QILRELDRLE LLLEQIRNVE AERDADLKEE RKTDTPPVGV LAALKGIGPE       420
     FAAVIWAEGL SRPFENRRQV AAYAGLAPTP WQSGSVNREQ GVSKSGNPRL RTTMIQLAWL       480
     WLRHQPRSEL SCWFQQRVAG HGGRVRKTMI AAMARKLLVA LWKYLTAGVV IEGAAMKTV        539
//

If you have problems or comments...

PBIL Back to PBIL home page