(data stored in ACNUC7421 zone)

EMBL: CP000489.PE137

CP000489.PE137       Location/Qualifiers
FT   CDS             122855..123550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0137"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   mes:Meso_0517 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68254"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB0"
FT                   /protein_id="ABL68254.1"
FT                   /translation="MPVSVLRHTDGRAYAARGIAILLLSGLTIATLPAAGLLAQTVQPV
FT                   VRESRDPFASHVAEASLRFGIPAHWIRAVRHVESAGNPQAVSPKGAMGLMQIMPKTWAA
FT                   LRARHALGDDPFDPRDNIFAGAAYLREMHDRYGTIAGMLAAYNAGPGRYDEHLISGRLL
FT                   PAETRAYVAALAPLMGGVTLPGSPPAVAPPRDWREAPLFTGSMTGSPDAERVQPGGLFL
FT                   RRSDAGAVQ"
     MPVSVLRHTD GRAYAARGIA ILLLSGLTIA TLPAAGLLAQ TVQPVVRESR DPFASHVAEA        60
     SLRFGIPAHW IRAVRHVESA GNPQAVSPKG AMGLMQIMPK TWAALRARHA LGDDPFDPRD       120
     NIFAGAAYLR EMHDRYGTIA GMLAAYNAGP GRYDEHLISG RLLPAETRAY VAALAPLMGG       180
     VTLPGSPPAV APPRDWREAP LFTGSMTGSP DAERVQPGGL FLRRSDAGAV Q                231
//

If you have problems or comments...

PBIL Back to PBIL home page