(data stored in ACNUC7421 zone)

EMBL: CP000489.PE138

CP000489.PE138       Location/Qualifiers
FT   CDS             123600..124181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68255"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB1"
FT                   /protein_id="ABL68255.1"
FT                   /translation="MKIAYADPPYIGCAHLYCDRPDYAGEVDHAALIDRLERDYDGWIL
FT                   HAAATPHSFAVLAPLVEPTGARWMAWVKGFAAFKRNVPVAWAWEPVIVKAARKPVVSKR
FT                   LVLRDWVQESITLRRGLTGAKPEAVCLWAFEMVAARPEDTLDDLFPGTGAVTAAWHSWQ
FT                   RKFTLPGDPVPALPPSDSARRGRSRTGGAS"
     MKIAYADPPY IGCAHLYCDR PDYAGEVDHA ALIDRLERDY DGWILHAAAT PHSFAVLAPL        60
     VEPTGARWMA WVKGFAAFKR NVPVAWAWEP VIVKAARKPV VSKRLVLRDW VQESITLRRG       120
     LTGAKPEAVC LWAFEMVAAR PEDTLDDLFP GTGAVTAAWH SWQRKFTLPG DPVPALPPSD       180
     SARRGRSRTG GAS                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page