(data stored in ACNUC7421 zone)

EMBL: CP000489.PE139

CP000489.PE139       Location/Qualifiers
FT   CDS             124423..126159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68256"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB2"
FT                   /protein_id="ABL68256.1"
FT                   /translation="MSNEDDFRIRPGGIRSSRSQRARPFVVQALAAAQKAGGRVSRSGR
FT                   IVSPGTSRFGRGRTAAVRANRLITRRTRLCTVKVRVVRRTGQAAALPRHLGYLGRDGVT
FT                   RGGEKARMFDPHSDDADIKDFAERSEDDRHHFRFIVSPEDAADMADLKRFTRELMAQAE
FT                   KDLGTELDWIAVDHWNTDNPHVHVILRGRADDGKDLVISRDYIREGLRDRAQDLITREL
FT                   GPRHDHEIHRSLMRQVEAERWTALDRQLLRDAGKPGVIDMAPHVDGPRDDYLPQKVGRL
FT                   RHLERLGLADQVGQAQWVIRPEAEIMLRELGERGDIIKRIHRALSGQGIDRGVSDYVFA
FT                   SEADGPILGRLVERGHDDELKGSAYVVIDGVDGRTHHIRLPHFDAAGDSAPGSIVELRS
FT                   YEDAKGARRTALAVRSDLDIRAQVTANGATWLDRQAVSRDPVALSEAGFGVEVRQAMKR
FT                   RAEHLIEEGLAERQGSRVIFARRLLDRLREREVGALAEKLAAETGMSYDRANTGDHVAG
FT                   TYRRRFALASGRFAMIDDGLGFKLVPWTPSLERHLDRHVSGVARADGGVDWSFGRKRGL
FT                   GL"
     MSNEDDFRIR PGGIRSSRSQ RARPFVVQAL AAAQKAGGRV SRSGRIVSPG TSRFGRGRTA        60
     AVRANRLITR RTRLCTVKVR VVRRTGQAAA LPRHLGYLGR DGVTRGGEKA RMFDPHSDDA       120
     DIKDFAERSE DDRHHFRFIV SPEDAADMAD LKRFTRELMA QAEKDLGTEL DWIAVDHWNT       180
     DNPHVHVILR GRADDGKDLV ISRDYIREGL RDRAQDLITR ELGPRHDHEI HRSLMRQVEA       240
     ERWTALDRQL LRDAGKPGVI DMAPHVDGPR DDYLPQKVGR LRHLERLGLA DQVGQAQWVI       300
     RPEAEIMLRE LGERGDIIKR IHRALSGQGI DRGVSDYVFA SEADGPILGR LVERGHDDEL       360
     KGSAYVVIDG VDGRTHHIRL PHFDAAGDSA PGSIVELRSY EDAKGARRTA LAVRSDLDIR       420
     AQVTANGATW LDRQAVSRDP VALSEAGFGV EVRQAMKRRA EHLIEEGLAE RQGSRVIFAR       480
     RLLDRLRERE VGALAEKLAA ETGMSYDRAN TGDHVAGTYR RRFALASGRF AMIDDGLGFK       540
     LVPWTPSLER HLDRHVSGVA RADGGVDWSF GRKRGLGL                               578
//

If you have problems or comments...

PBIL Back to PBIL home page