(data stored in ACNUC7421 zone)

EMBL: CP000489.PE14

CP000489.PE14        Location/Qualifiers
FT   CDS             12091..12444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0014"
FT                   /product="protein of unknown function DUF454"
FT                   /note="PFAM: protein of unknown function DUF454; KEGG:
FT                   atc:AGR_C_4462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68131"
FT                   /db_xref="GOA:A1AXY7"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY7"
FT                   /protein_id="ABL68131.1"
FT                   /translation="MRYLWFSMGWLTLTLGVIGVFVPVLPTVPFLLLAVWAFMRSSPRL
FT                   GARIMRHPQFGPPIRAWRKRGVIGRGAKIWAVAGMSAGVAWAVWLGLDPRFIAAQALAC
FT                   TAIAAWLVTRPEI"
     MRYLWFSMGW LTLTLGVIGV FVPVLPTVPF LLLAVWAFMR SSPRLGARIM RHPQFGPPIR        60
     AWRKRGVIGR GAKIWAVAGM SAGVAWAVWL GLDPRFIAAQ ALACTAIAAW LVTRPEI          117
//

If you have problems or comments...

PBIL Back to PBIL home page