(data stored in ACNUC7421 zone)

EMBL: CP000489.PE143

CP000489.PE143       Location/Qualifiers
FT   CDS             129135..129545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68260"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB6"
FT                   /protein_id="ABL68260.1"
FT                   /translation="MPEHADKKRRLSVYLDPELMLLLADYADRRGKSRSLVAEAAIASF
FT                   LTPDVDERQEAAMTRRLDRIDRNVQRLERDIGIANEAFAIFVRSWLTATPAPLDAAARA
FT                   QGGDRYDRFLEALGRRLVSGPRLQQEVPEERG"
     MPEHADKKRR LSVYLDPELM LLLADYADRR GKSRSLVAEA AIASFLTPDV DERQEAAMTR        60
     RLDRIDRNVQ RLERDIGIAN EAFAIFVRSW LTATPAPLDA AARAQGGDRY DRFLEALGRR       120
     LVSGPRLQQE VPEERG                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page