(data stored in ACNUC7421 zone)

EMBL: CP000489.PE144

CP000489.PE144       Location/Qualifiers
FT   CDS             complement(129586..129894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0144"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   sme:SMb20627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68261"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB7"
FT                   /protein_id="ABL68261.1"
FT                   /translation="MRRPVAWTRAALDDIKEQIAFIAQDNPAAARRVADRIRDTGTALG
FT                   DMATGRPGRVTGSYEKSVSRLPYIIAYELRAIAGRESVVILRVIHTSQDWPDEDWPH"
     MRRPVAWTRA ALDDIKEQIA FIAQDNPAAA RRVADRIRDT GTALGDMATG RPGRVTGSYE        60
     KSVSRLPYII AYELRAIAGR ESVVILRVIH TSQDWPDEDW PH                          102
//

If you have problems or comments...

PBIL Back to PBIL home page