(data stored in ACNUC7421 zone)

EMBL: CP000489.PE145

CP000489.PE145       Location/Qualifiers
FT   CDS             complement(129891..130160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0145"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: sme:SMb20628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68262"
FT                   /db_xref="GOA:A1AYB8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB8"
FT                   /protein_id="ABL68262.1"
FT                   /translation="MTASTTMTIRVSPETKQKLERIAGETRRSKSFLAAEAVSAYVERE
FT                   LEIIDGIRRGMADAAAGRVVSHEDAMAEIHAVIDAAEATRAGKA"
     MTASTTMTIR VSPETKQKLE RIAGETRRSK SFLAAEAVSA YVERELEIID GIRRGMADAA        60
     AGRVVSHEDA MAEIHAVIDA AEATRAGKA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page