(data stored in ACNUC7421 zone)

EMBL: CP000489.PE146

CP000489.PE146       Location/Qualifiers
FT   CDS             complement(130357..130599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68263"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB9"
FT                   /protein_id="ABL68263.1"
FT                   /translation="MTKLKLGPIADDTPVKLTVELPAGLHRDLVLYGELLGRSGGQGAV
FT                   APQKLVVPMLERFIASDRGFAKARRSISVRGQPNG"
     MTKLKLGPIA DDTPVKLTVE LPAGLHRDLV LYGELLGRSG GQGAVAPQKL VVPMLERFIA        60
     SDRGFAKARR SISVRGQPNG                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page