(data stored in ACNUC7421 zone)

EMBL: CP000489.PE147

CP000489.PE147       Location/Qualifiers
FT   CDS             complement(130604..131779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0147"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   mes:Meso_0500 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68264"
FT                   /db_xref="GOA:A1AYC0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC0"
FT                   /protein_id="ABL68264.1"
FT                   /translation="MSDREAAAAPMRLRAEPPRVTRLSRKVLAGLGGIAALGIGAALIF
FT                   ALQTRDVERGGEELFSTENRTTADGLAELPRDYSGPVLGPALPGDLGKPILNARNRGEP
FT                   VPAPAPDIASPLEAVPAMDAAEQQRLAEEEAARLSGVFFQGGPRPAGGPDTGAGSAGSA
FT                   SGGSGTMGEPGATSAQDRHAAFLGAAADRITVVPDRVEAPASPYILQAGSVIPAALVTG
FT                   IRSDLPGQIIAQVTQPVYDSPTGSILLIPQGTRIIGEYDADVTFGQRRVLLVWNRLIYP
FT                   DGRSLVLERLPGADASGYAGLEDGVDYHWGELMKVAGLSTLLAVGTELAAGDEEDRLIR
FT                   AIRDGAQDTVNQAGQQIVQRQLQVAPTLTIRPGFPVRILVSRDLVFENAGG"
     MSDREAAAAP MRLRAEPPRV TRLSRKVLAG LGGIAALGIG AALIFALQTR DVERGGEELF        60
     STENRTTADG LAELPRDYSG PVLGPALPGD LGKPILNARN RGEPVPAPAP DIASPLEAVP       120
     AMDAAEQQRL AEEEAARLSG VFFQGGPRPA GGPDTGAGSA GSASGGSGTM GEPGATSAQD       180
     RHAAFLGAAA DRITVVPDRV EAPASPYILQ AGSVIPAALV TGIRSDLPGQ IIAQVTQPVY       240
     DSPTGSILLI PQGTRIIGEY DADVTFGQRR VLLVWNRLIY PDGRSLVLER LPGADASGYA       300
     GLEDGVDYHW GELMKVAGLS TLLAVGTELA AGDEEDRLIR AIRDGAQDTV NQAGQQIVQR       360
     QLQVAPTLTI RPGFPVRILV SRDLVFENAG G                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page