(data stored in ACNUC7421 zone)

EMBL: CP000489.PE149

CP000489.PE149       Location/Qualifiers
FT   CDS             complement(132780..133469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0149"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein; KEGG: mes:Meso_0502
FT                   conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68266"
FT                   /db_xref="GOA:A1AYC2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC2"
FT                   /protein_id="ABL68266.1"
FT                   /translation="MNLFRRPTTHYGKTPEPVTPYQKATQVWDERIGSARVQARNWRYM
FT                   AFACLFLAAGFASALVWQSARGTVVPWVVQVDDLGQAQAVAPAAADYRPTDPQISWHLG
FT                   RFVEQVRSIPADPVILRQNWLRAYEFTTDRGAAALNDHARGNDPFAKLGEQQVSVEVSS
FT                   VIRASPDSFRVAWTEKRYENGQLSNTERWTAILTVVLQTPRTAETLRANPLGIYVNAIS
FT                   WSREMSQ"
     MNLFRRPTTH YGKTPEPVTP YQKATQVWDE RIGSARVQAR NWRYMAFACL FLAAGFASAL        60
     VWQSARGTVV PWVVQVDDLG QAQAVAPAAA DYRPTDPQIS WHLGRFVEQV RSIPADPVIL       120
     RQNWLRAYEF TTDRGAAALN DHARGNDPFA KLGEQQVSVE VSSVIRASPD SFRVAWTEKR       180
     YENGQLSNTE RWTAILTVVL QTPRTAETLR ANPLGIYVNA ISWSREMSQ                   229
//

If you have problems or comments...

PBIL Back to PBIL home page