(data stored in ACNUC7421 zone)

EMBL: CP000489.PE15

CP000489.PE15        Location/Qualifiers
FT   CDS             12535..13119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0015"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA; KEGG: sme:SMb20186 glutathione-dependent
FT                   formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68132"
FT                   /db_xref="GOA:A1AXY8"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXY8"
FT                   /protein_id="ABL68132.1"
FT                   /translation="MVDTSGVKIHPAVDNGIKPAQPGFAGGTLHCKCSTNPVRVAVRAQ
FT                   TAHNHVCGCTKCWKPEGAIFSQVAVVGRDALEVLEGAEKLEIVNAEAPIQRHRCRDCGV
FT                   HMYGRIENRDHPFYGLDFVHTELSDEDGWSAPEFAAFVSSIIESGVDPSRMEAIRARLR
FT                   ELGLEPYDALSPPLMDAIATHIAKRSGALAA"
     MVDTSGVKIH PAVDNGIKPA QPGFAGGTLH CKCSTNPVRV AVRAQTAHNH VCGCTKCWKP        60
     EGAIFSQVAV VGRDALEVLE GAEKLEIVNA EAPIQRHRCR DCGVHMYGRI ENRDHPFYGL       120
     DFVHTELSDE DGWSAPEFAA FVSSIIESGV DPSRMEAIRA RLRELGLEPY DALSPPLMDA       180
     IATHIAKRSG ALAA                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page