(data stored in ACNUC7421 zone)

EMBL: CP000489.PE150

CP000489.PE150       Location/Qualifiers
FT   CDS             complement(133466..134785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0150"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: mes:Meso_0503 TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68267"
FT                   /db_xref="GOA:A1AYC3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC3"
FT                   /protein_id="ABL68267.1"
FT                   /translation="MGGSGVIDNFLAVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAA
FT                   LFWAWGAEDDILARLVKKTIFVGVFAWLITNWNSLARIVFDSFAGLGLMASGTGFTAAD
FT                   LMRPGRVAQTGLDAGRPLLESISDLMGWVAVFENLIQILCLFFAWALVILAFFILAVQL
FT                   FVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVLAVIIGIGSTLFS
FT                   QFTTGFGGVAPTVDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAVGTGLAV
FT                   GGAALVAGGATVLGAKGGAMAARGGAATAGAASAAYTLHSAGESGLGGALSGVAGIGKG
FT                   AGIAALSPLRKAAASISKSHAAGVKTAFTGTGGSTTQGTLGGVGASVPTPSSPGSPPAW
FT                   AQRLRGQAVGRGATVAAHAVRSGDSHGPGASVSLSESDKP"
     MGGSGVIDNF LAVFTSYIDS GFGLLGGEVA FIATTLIVID VTLAALFWAW GAEDDILARL        60
     VKKTIFVGVF AWLITNWNSL ARIVFDSFAG LGLMASGTGF TAADLMRPGR VAQTGLDAGR       120
     PLLESISDLM GWVAVFENLI QILCLFFAWA LVILAFFILA VQLFVTLIEF KLTTLAGFVL       180
     IPFGLFGKTA FMAERVLGNV VSSGIKVLVL AVIIGIGSTL FSQFTTGFGG VAPTVDDAMA       240
     IVLAALSLLG LGIFGPGIAN GLVSGGPQLG AGAAVGTGLA VGGAALVAGG ATVLGAKGGA       300
     MAARGGAATA GAASAAYTLH SAGESGLGGA LSGVAGIGKG AGIAALSPLR KAAASISKSH       360
     AAGVKTAFTG TGGSTTQGTL GGVGASVPTP SSPGSPPAWA QRLRGQAVGR GATVAAHAVR       420
     SGDSHGPGAS VSLSESDKP                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page