(data stored in ACNUC7421 zone)

EMBL: CP000489.PE152

CP000489.PE152       Location/Qualifiers
FT   CDS             complement(135101..135901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0152"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /note="KEGG: mes:Meso_3855 conjugal transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68269"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC5"
FT                   /protein_id="ABL68269.1"
FT                   /translation="MTRSTTVTMRRHIRAIASTTALALALATPLALAPLLTTPAHAFFG
FT                   GFGRIVYDPTNHAENLLTAARSLEQINNQIASLQNEAQMLINQARDLASLPHSSLQQLQ
FT                   QNVTRTQQLLDEAQNIAFEVQEVDQAFEREYGTPDLSTSEQQLLADARTRWSNTMGGLQ
FT                   DAMRVQSGVTNNIEAQRAEMAALVEQSQNADGALQASQAGNQLLALQSQQLSDLTALLA
FT                   ATGRAEALSEAERSAAAEQGRIQRERFLTPGAGYQPGNARMFND"
     MTRSTTVTMR RHIRAIASTT ALALALATPL ALAPLLTTPA HAFFGGFGRI VYDPTNHAEN        60
     LLTAARSLEQ INNQIASLQN EAQMLINQAR DLASLPHSSL QQLQQNVTRT QQLLDEAQNI       120
     AFEVQEVDQA FEREYGTPDL STSEQQLLAD ARTRWSNTMG GLQDAMRVQS GVTNNIEAQR       180
     AEMAALVEQS QNADGALQAS QAGNQLLALQ SQQLSDLTAL LAATGRAEAL SEAERSAAAE       240
     QGRIQRERFL TPGAGYQPGN ARMFND                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page