(data stored in ACNUC7421 zone)

EMBL: CP000489.PE154

CP000489.PE154       Location/Qualifiers
FT   CDS             complement(138528..138809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0154"
FT                   /product="conjugal transfer protein TrbB"
FT                   /note="KEGG: mes:Meso_0507 conjugal transfer protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68271"
FT                   /db_xref="GOA:A1AYC7"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC7"
FT                   /protein_id="ABL68271.1"
FT                   /translation="MAMSFEVLDTVPGFSVPVHRALTEPILLGGASRSVAILNGTLAGA
FT                   VGLGLQLWLAGILIWAVGHLAAVWAAKRDPLFVEVGRRHLRIPGHLAV"
     MAMSFEVLDT VPGFSVPVHR ALTEPILLGG ASRSVAILNG TLAGAVGLGL QLWLAGILIW        60
     AVGHLAAVWA AKRDPLFVEV GRRHLRIPGH LAV                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page