(data stored in ACNUC7421 zone)

EMBL: CP000489.PE156

CP000489.PE156       Location/Qualifiers
FT   CDS             complement(139135..140139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0156"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mes:Meso_2324 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68273"
FT                   /db_xref="GOA:A1AYC9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC9"
FT                   /protein_id="ABL68273.1"
FT                   /translation="MAGSDHIEAMVERGARMLRTALGPAISALLRDPGIVEVMLNPDGR
FT                   IWIDRLRDGLAETGQVLSPADGERIIRLVAHHVGVEVHARSPRVSAELPETGERFEGLL
FT                   PPVVVAPAFAIRKPAVAVFTLDDYVAAGIMTRMQAEALRLGVATRANILVAGGTSTGKT
FT                   TLTNALLAEVAKTQDRVVVIEDTRELQCAAPNLVAMRTKDGVATLSDLVRSSLRLRPDR
FT                   IPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSGIGALRRLEQLIQEAVITVPRALIAE
FT                   TVDLVAVLSGRGSNRHLTELVRINGLGPDGDYRIAPVIPDTDTHIAENTGEPE"
     MAGSDHIEAM VERGARMLRT ALGPAISALL RDPGIVEVML NPDGRIWIDR LRDGLAETGQ        60
     VLSPADGERI IRLVAHHVGV EVHARSPRVS AELPETGERF EGLLPPVVVA PAFAIRKPAV       120
     AVFTLDDYVA AGIMTRMQAE ALRLGVATRA NILVAGGTST GKTTLTNALL AEVAKTQDRV       180
     VVIEDTRELQ CAAPNLVAMR TKDGVATLSD LVRSSLRLRP DRIPIGEVRG AEALDLLKAW       240
     GTGHPGGIGT IHAGSGIGAL RRLEQLIQEA VITVPRALIA ETVDLVAVLS GRGSNRHLTE       300
     LVRINGLGPD GDYRIAPVIP DTDTHIAENT GEPE                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page