(data stored in ACNUC7421 zone)

EMBL: CP000489.PE157

CP000489.PE157       Location/Qualifiers
FT   CDS             complement(140328..141215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0157"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: nwi:Nwi_0252 transcriptional
FT                   regulatory protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68274"
FT                   /db_xref="GOA:A1AYD0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD0"
FT                   /protein_id="ABL68274.1"
FT                   /translation="MDLRHLRYVVATARNGSFSAAALELEVQQPIVSRRIRELEEELGT
FT                   ALFDRSTAGAKLTPVGEDFADMAGRILDDFQRLTDRTRAAVEGRRGSVALGFYRSLSSG
FT                   SFRFALRRFRESHPDIGLDLLEAPFVELMADLHSGKLDVAVILGDPDRCPVLNTMAIGT
FT                   EHLMVALPEDHPLAEKPFVYWSDLKGERFLISHQDPGPDIRNILIAKLAAPSDGPEIAN
FT                   LHLSRESILSLVGAGEGISLQCECASGLTGLGAVFRPVHDGNGATRIGYIACWHPDNGN
FT                   PALQTFLEALKSGT"
     MDLRHLRYVV ATARNGSFSA AALELEVQQP IVSRRIRELE EELGTALFDR STAGAKLTPV        60
     GEDFADMAGR ILDDFQRLTD RTRAAVEGRR GSVALGFYRS LSSGSFRFAL RRFRESHPDI       120
     GLDLLEAPFV ELMADLHSGK LDVAVILGDP DRCPVLNTMA IGTEHLMVAL PEDHPLAEKP       180
     FVYWSDLKGE RFLISHQDPG PDIRNILIAK LAAPSDGPEI ANLHLSRESI LSLVGAGEGI       240
     SLQCECASGL TGLGAVFRPV HDGNGATRIG YIACWHPDNG NPALQTFLEA LKSGT            295
//

If you have problems or comments...

PBIL Back to PBIL home page