(data stored in ACNUC7421 zone)

EMBL: CP000489.PE158

CP000489.PE158       Location/Qualifiers
FT   CDS             complement(141246..141467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr6069 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68275"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD1"
FT                   /protein_id="ABL68275.1"
FT                   /translation="MEEYIGLDVSMKETAVSIHRDGKRVWRGKCASAPKVIAKVIRKRA
FT                   PIAKRVVFDFVATAVPELGQVAHQQERA"
     MEEYIGLDVS MKETAVSIHR DGKRVWRGKC ASAPKVIAKV IRKRAPIAKR VVFDFVATAV        60
     PELGQVAHQQ ERA                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page