(data stored in ACNUC7421 zone)

EMBL: CP000489.PE16

CP000489.PE16        Location/Qualifiers
FT   CDS             13223..14350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0016"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_2576 alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68133"
FT                   /db_xref="GOA:A1AXY9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY9"
FT                   /protein_id="ABL68133.1"
FT                   /translation="MRTRAAVALEAGKPLEVMEVNLEGPKAGEVMVEIKATGICHTDEF
FT                   TLSGADPEGLFPSILGHEGAGVVVEVGPGVTSVKPGDHVIPLYTPECRQCASCLSGKTN
FT                   LCTAIRATQGQGLMPDGTSRFSMLDGTPIFHYMGCSTFSNYTVLPEIAVAKVREDAPFD
FT                   KICYIGCGVTTGIGAVINTAKVEIGAKAVVFGLGGIGLNVLQGLRLAGADMIIGVDLND
FT                   DKKPMAEHFGMTHFINPKNCENVVQEIVNLTKTPFDQIGGADYSFDCTGNVKVMRDALE
FT                   CTHRGWGQSIIIGVAPAGAEISTRPFQLVTGRVWKGTAFGGARGRTDVPQIVDWYMDGK
FT                   IEIDPMITHTLSLDDINKGFDLMHAGESIRSVVLY"
     MRTRAAVALE AGKPLEVMEV NLEGPKAGEV MVEIKATGIC HTDEFTLSGA DPEGLFPSIL        60
     GHEGAGVVVE VGPGVTSVKP GDHVIPLYTP ECRQCASCLS GKTNLCTAIR ATQGQGLMPD       120
     GTSRFSMLDG TPIFHYMGCS TFSNYTVLPE IAVAKVREDA PFDKICYIGC GVTTGIGAVI       180
     NTAKVEIGAK AVVFGLGGIG LNVLQGLRLA GADMIIGVDL NDDKKPMAEH FGMTHFINPK       240
     NCENVVQEIV NLTKTPFDQI GGADYSFDCT GNVKVMRDAL ECTHRGWGQS IIIGVAPAGA       300
     EISTRPFQLV TGRVWKGTAF GGARGRTDVP QIVDWYMDGK IEIDPMITHT LSLDDINKGF       360
     DLMHAGESIR SVVLY                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page