(data stored in ACNUC7421 zone)

EMBL: CP000489.PE160

CP000489.PE160       Location/Qualifiers
FT   CDS             complement(142033..145134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0160"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   atc:AGR_L_494 RND pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68277"
FT                   /db_xref="GOA:A1AYD3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD3"
FT                   /protein_id="ABL68277.1"
FT                   /translation="MFLTRISATHPVFATMMMVALVVFGAFSYPRLGLDQYPDVDVPIV
FT                   VVMTTYPGATPETVETEISRPIEEAINTVGGLDQVTSTSYEGRSVVVAEFRLDVAGPAA
FT                   VQEVRDKLAPLEAGFPADVDKPVVSRFNPSDQPILSVAISGPRFDVAELTALAEQRIIR
FT                   QLTTISGVGQVTLVGGRMKQVDIVIDETRLRALSVGIDEVLAALRGGNQNRPAGNLVTG
FT                   FSDLGIQVQGRIDEPADFLDMIVARRGGGPVYLRDVATVTDGAADAESLALYDGRPALA
FT                   LDIVKVQDANTVQVADEVIARLDRLNEELAESGVTLSVVTDASLPIRESVAQVQATLIE
FT                   GAALAVAIVFLFLNSWRSTVITGLTLPIAMIGTLAVISVLGFTLNTLSLLALTLSIGIL
FT                   VDDAIVVRENITRHLHMGKSHLQAALDGTGEIALAVLATTATIVAVFLPVAFMDGIVGR
FT                   FFYEFGVTVSAAVLISLFVAFTLDPMLSSVWYDPDAQPDAKRGPIGRLIARFERGFERL
FT                   AEAYRHLIGWTLRHRLVTLIATAGIFIGSIFMVPLVGAEFTPTADEGRFQINVQTPVGS
FT                   SLDYTAAKVGQIEAALREFPELDTLYSTVNTGTATGKHRAAILVGLVPQGERTRTPLML
FT                   ADPIRQRLSVIPGIEIAIVQQGLGGGDSPIRLSVLGDDQAELERIAAGLMERMRGIPGM
FT                   VDIASSADAASSVIAVRLRSEAASDLGLGIHQIGAALAPLIGGEDVTTWTDSSGETHDV
FT                   VVRLPAERRADTDALGDLMLTTGGTDAGGAPVMVRLDQVARFVQVETASEIRRLDMTRE
FT                   VQISADISGRVLGDATADLEALIATLDLPQGYRIQFGGDSSTMQETMGHMITALLMAVT
FT                   FIYIVLASQFGNFLQPLAIMAALPLSLIGVLLGLMVAGSTINMFSLIGFIMLMGLVTKN
FT                   GILLIDFANRERRRGLPLNEALVNAGAIRFQPIVMTTLAMIVGMIPLALAVGGGGAQRA
FT                   PMAHAVIGGLISSTILTLIVVPVILSCIDGFWKRVARFLPEAPN"
     MFLTRISATH PVFATMMMVA LVVFGAFSYP RLGLDQYPDV DVPIVVVMTT YPGATPETVE        60
     TEISRPIEEA INTVGGLDQV TSTSYEGRSV VVAEFRLDVA GPAAVQEVRD KLAPLEAGFP       120
     ADVDKPVVSR FNPSDQPILS VAISGPRFDV AELTALAEQR IIRQLTTISG VGQVTLVGGR       180
     MKQVDIVIDE TRLRALSVGI DEVLAALRGG NQNRPAGNLV TGFSDLGIQV QGRIDEPADF       240
     LDMIVARRGG GPVYLRDVAT VTDGAADAES LALYDGRPAL ALDIVKVQDA NTVQVADEVI       300
     ARLDRLNEEL AESGVTLSVV TDASLPIRES VAQVQATLIE GAALAVAIVF LFLNSWRSTV       360
     ITGLTLPIAM IGTLAVISVL GFTLNTLSLL ALTLSIGILV DDAIVVRENI TRHLHMGKSH       420
     LQAALDGTGE IALAVLATTA TIVAVFLPVA FMDGIVGRFF YEFGVTVSAA VLISLFVAFT       480
     LDPMLSSVWY DPDAQPDAKR GPIGRLIARF ERGFERLAEA YRHLIGWTLR HRLVTLIATA       540
     GIFIGSIFMV PLVGAEFTPT ADEGRFQINV QTPVGSSLDY TAAKVGQIEA ALREFPELDT       600
     LYSTVNTGTA TGKHRAAILV GLVPQGERTR TPLMLADPIR QRLSVIPGIE IAIVQQGLGG       660
     GDSPIRLSVL GDDQAELERI AAGLMERMRG IPGMVDIASS ADAASSVIAV RLRSEAASDL       720
     GLGIHQIGAA LAPLIGGEDV TTWTDSSGET HDVVVRLPAE RRADTDALGD LMLTTGGTDA       780
     GGAPVMVRLD QVARFVQVET ASEIRRLDMT REVQISADIS GRVLGDATAD LEALIATLDL       840
     PQGYRIQFGG DSSTMQETMG HMITALLMAV TFIYIVLASQ FGNFLQPLAI MAALPLSLIG       900
     VLLGLMVAGS TINMFSLIGF IMLMGLVTKN GILLIDFANR ERRRGLPLNE ALVNAGAIRF       960
     QPIVMTTLAM IVGMIPLALA VGGGGAQRAP MAHAVIGGLI SSTILTLIVV PVILSCIDGF      1020
     WKRVARFLPE APN                                                         1033
//

If you have problems or comments...

PBIL Back to PBIL home page