(data stored in ACNUC7421 zone)

EMBL: CP000489.PE162

CP000489.PE162       Location/Qualifiers
FT   CDS             complement(146505..147182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0162"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   ccr:CC0351 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68279"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD5"
FT                   /protein_id="ABL68279.1"
FT                   /translation="MAQDRMIFGLGAASAPEYQGSDQQSARAIPLIDIARGPFFMNLRN
FT                   GIGAYPLEYGDFRFGTSIVYIPGFDLPHALGEVSGSAGARLFTDWERGGVNATFGVTRA
FT                   VSGDLEGTLVDASLSYRHNVTPKLTLIPVIGTTWSDSDYTNSYFGVTPAQAAAAGISSF
FT                   SPGGGFKDVSIGLTANYRVTERVNLTASATMSKLLGDAKDSPIVFDDTQAFGFIGVSYR
FT                   FGN"
     MAQDRMIFGL GAASAPEYQG SDQQSARAIP LIDIARGPFF MNLRNGIGAY PLEYGDFRFG        60
     TSIVYIPGFD LPHALGEVSG SAGARLFTDW ERGGVNATFG VTRAVSGDLE GTLVDASLSY       120
     RHNVTPKLTL IPVIGTTWSD SDYTNSYFGV TPAQAAAAGI SSFSPGGGFK DVSIGLTANY       180
     RVTERVNLTA SATMSKLLGD AKDSPIVFDD TQAFGFIGVS YRFGN                       225
//

If you have problems or comments...

PBIL Back to PBIL home page