(data stored in ACNUC7421 zone)

EMBL: CP000489.PE165

CP000489.PE165       Location/Qualifiers
FT   CDS             complement(148664..149005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0166"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: nwi:Nwi_3123
FT                   transcriptional regulatory protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68282"
FT                   /db_xref="GOA:A1AYD8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD8"
FT                   /protein_id="ABL68282.1"
FT                   /translation="MEDKQALAAFAALSQETRLRIVRLLGTAGPEGLPAGAIGEAMDGA
FT                   TSSRMSFHLGPLEHAGLVTSRREGRQIIYSVTYQALSDLIAFLMRDCCQGRPEICAPAV
FT                   AALSCSSAI"
     MEDKQALAAF AALSQETRLR IVRLLGTAGP EGLPAGAIGE AMDGATSSRM SFHLGPLEHA        60
     GLVTSRREGR QIIYSVTYQA LSDLIAFLMR DCCQGRPEIC APAVAALSCS SAI              113
//

If you have problems or comments...

PBIL Back to PBIL home page