(data stored in ACNUC7421 zone)

EMBL: CP000489.PE169

CP000489.PE169       Location/Qualifiers
FT   CDS             complement(151979..152380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0170"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   gka:GK1990 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68286"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE2"
FT                   /protein_id="ABL68286.1"
FT                   /translation="MEPFLTEFTVEWGDCDEAGIVFYPNYFYWLDCTFQRLLRARGLGQ
FT                   RQTRDRFGAVTPLLDVALRFRAPVRYDEVLRIEARIAEWQERRFRIGYTLTSGERLIAE
FT                   GHELRAWAVQTDDGLKGAPIAEEFRRLLE"
     MEPFLTEFTV EWGDCDEAGI VFYPNYFYWL DCTFQRLLRA RGLGQRQTRD RFGAVTPLLD        60
     VALRFRAPVR YDEVLRIEAR IAEWQERRFR IGYTLTSGER LIAEGHELRA WAVQTDDGLK       120
     GAPIAEEFRR LLE                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page