(data stored in ACNUC7421 zone)

EMBL: CP000489.PE17

CP000489.PE17        Location/Qualifiers
FT   CDS             14426..15061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0017"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14, ClpP; KEGG: hne:HNE_0542
FT                   putative ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68134"
FT                   /db_xref="GOA:A1AXZ0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ0"
FT                   /protein_id="ABL68134.1"
FT                   /translation="MAKHFHLDDDDDDDDERRQEGSKDEGLGLPEGDKIGKLYFKSRTV
FT                   IVAGPITDKLAQRTVAHLLALAEDSDEPINMLISSPGGHVESGDMIHDVIKFIRPTVRT
FT                   IGSGWVASAGALIFVGADKENRYCLPNTRFLIHQPSGGIGGTSTDMMIQAEQVRLMRDR
FT                   LNQIFAEATGQPVERIEKDTQRDFWLNTQEALDYGLLGKVIRSVDELK"
     MAKHFHLDDD DDDDDERRQE GSKDEGLGLP EGDKIGKLYF KSRTVIVAGP ITDKLAQRTV        60
     AHLLALAEDS DEPINMLISS PGGHVESGDM IHDVIKFIRP TVRTIGSGWV ASAGALIFVG       120
     ADKENRYCLP NTRFLIHQPS GGIGGTSTDM MIQAEQVRLM RDRLNQIFAE ATGQPVERIE       180
     KDTQRDFWLN TQEALDYGLL GKVIRSVDEL K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page