(data stored in ACNUC7421 zone)

EMBL: CP000489.PE170

CP000489.PE170       Location/Qualifiers
FT   CDS             152463..153608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0171"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: bja:blr0106
FT                   probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68287"
FT                   /db_xref="GOA:A1AYE3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE3"
FT                   /protein_id="ABL68287.1"
FT                   /translation="MKRIAVLGGGPGGLYFAYLWKSRHPADSVTLFEQNPEGATFGFGV
FT                   VFSDRAMDFLRADDPETADRITEKMETWSDITLVHHGQRVTIDGVGFSAIGRLELILLM
FT                   QERARDAGVDLRFGTVIGSVAELADYDVIVAADGVNSLVRRSFEGDFQTSISYLDEKFA
FT                   WFGTTKRFETLTQTFVTCEHGTFNAHHYRYSPTMSTFIVECDRASWLKAGFDQLGPDEA
FT                   KTRCEEIFAEALDGHGLVANKSNWRNFPWIWNDRWSHRNMVLIGDALHTAHYSIGSGTR
FT                   LALEDVQALVAALEAHPGDPGAAFAEYEATRRPIVEKLVRAAKTSAAWYADFPAHMQLA
FT                   PLDMAYSYITRSGRIDDQRLTAMSPRFMAEYGAARTVPAAG"
     MKRIAVLGGG PGGLYFAYLW KSRHPADSVT LFEQNPEGAT FGFGVVFSDR AMDFLRADDP        60
     ETADRITEKM ETWSDITLVH HGQRVTIDGV GFSAIGRLEL ILLMQERARD AGVDLRFGTV       120
     IGSVAELADY DVIVAADGVN SLVRRSFEGD FQTSISYLDE KFAWFGTTKR FETLTQTFVT       180
     CEHGTFNAHH YRYSPTMSTF IVECDRASWL KAGFDQLGPD EAKTRCEEIF AEALDGHGLV       240
     ANKSNWRNFP WIWNDRWSHR NMVLIGDALH TAHYSIGSGT RLALEDVQAL VAALEAHPGD       300
     PGAAFAEYEA TRRPIVEKLV RAAKTSAAWY ADFPAHMQLA PLDMAYSYIT RSGRIDDQRL       360
     TAMSPRFMAE YGAARTVPAA G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page