(data stored in ACNUC7421 zone)

EMBL: CP000489.PE173

CP000489.PE173       Location/Qualifiers
FT   CDS             156090..156743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0174"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase, N-terminal domain; KEGG:
FT                   mlo:mlr1135 maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68290"
FT                   /db_xref="GOA:A1AYE6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE6"
FT                   /protein_id="ABL68290.1"
FT                   /translation="MTRPVLHNYYRSSTSYRVRIALALKGVDYDYAALHLRKGDQRSDA
FT                   FLALNPQGLVPALEWGDGQILTQSLAIIEYLDEIIPQPPLLPSDPAGRARVRSLADMIA
FT                   LDIHPINNLRVLAYLKNHFGADDEATAEWFRHWVSEGFAALEARLARDPQTGTFCHGDR
FT                   VGLADICLAAQITNNARFGVDMTPWPTIRRIGEALAGIEAFRQAAPDRQPDNET"
     MTRPVLHNYY RSSTSYRVRI ALALKGVDYD YAALHLRKGD QRSDAFLALN PQGLVPALEW        60
     GDGQILTQSL AIIEYLDEII PQPPLLPSDP AGRARVRSLA DMIALDIHPI NNLRVLAYLK       120
     NHFGADDEAT AEWFRHWVSE GFAALEARLA RDPQTGTFCH GDRVGLADIC LAAQITNNAR       180
     FGVDMTPWPT IRRIGEALAG IEAFRQAAPD RQPDNET                                217
//

If you have problems or comments...

PBIL Back to PBIL home page