(data stored in ACNUC7421 zone)

EMBL: CP000489.PE175

CP000489.PE175       Location/Qualifiers
FT   CDS             157992..158912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0176"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bja:blr1064
FT                   ABC transporter permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68292"
FT                   /db_xref="GOA:A1AYE8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE8"
FT                   /protein_id="ABL68292.1"
FT                   /translation="MDTVLFVNQLLNGIQLGLILFLLAAGLSLVFGIMDFINLAHGVFY
FT                   MLGAYICATVAIASGSFILGFVVALPAVLVLGLATEWLIVRHFYKRDHLDQVLVTFGLV
FT                   LCADTAVKYLWGPQGLSVPLPAWLGGQVALGGITLPAYRLFIVAVAAVVALALWQVIAR
FT                   TRVGMMVRASASNEEMARALGIETRMIFALVFAIGAVLAGIGGIMVAPITGASIGMGNQ
FT                   IVILALVVIIIGGIGSIFGAFVAAIGVGLIDTLGRAYLPSILGAVFSPSVASSAGPALA
FT                   SILIYLTMTLVLVFRPSGLFPPANR"
     MDTVLFVNQL LNGIQLGLIL FLLAAGLSLV FGIMDFINLA HGVFYMLGAY ICATVAIASG        60
     SFILGFVVAL PAVLVLGLAT EWLIVRHFYK RDHLDQVLVT FGLVLCADTA VKYLWGPQGL       120
     SVPLPAWLGG QVALGGITLP AYRLFIVAVA AVVALALWQV IARTRVGMMV RASASNEEMA       180
     RALGIETRMI FALVFAIGAV LAGIGGIMVA PITGASIGMG NQIVILALVV IIIGGIGSIF       240
     GAFVAAIGVG LIDTLGRAYL PSILGAVFSP SVASSAGPAL ASILIYLTMT LVLVFRPSGL       300
     FPPANR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page