(data stored in ACNUC7421 zone)

EMBL: CP000489.PE177

CP000489.PE177       Location/Qualifiers
FT   CDS             159915..160664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0178"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr1066 ABC transporter ATP-binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68294"
FT                   /db_xref="GOA:A1AYF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF0"
FT                   /protein_id="ABL68294.1"
FT                   /translation="MTPALQVNRLNKYFGGLHATRDVSMTLPRGELHAVIGPNGAGKTT
FT                   LISQLFGELRPSSGQVLIEGRDVTHRPTHERAGLGMARSFQITTLVRDLTVAENVILAL
FT                   LARQGHAGRFWRRVDRNAGLQADAAGALARIGMPATQLGRRVSDLSHGEQRMLELAIAM
FT                   VGDPTLILLDEPMAGLGSEESRAMTRFLAQLKGKTTVLLVEHDMEAVFELADRLTVLVR
FT                   GEVVAVGTPAQIRDDERVRDAYLGEDA"
     MTPALQVNRL NKYFGGLHAT RDVSMTLPRG ELHAVIGPNG AGKTTLISQL FGELRPSSGQ        60
     VLIEGRDVTH RPTHERAGLG MARSFQITTL VRDLTVAENV ILALLARQGH AGRFWRRVDR       120
     NAGLQADAAG ALARIGMPAT QLGRRVSDLS HGEQRMLELA IAMVGDPTLI LLDEPMAGLG       180
     SEESRAMTRF LAQLKGKTTV LLVEHDMEAV FELADRLTVL VRGEVVAVGT PAQIRDDERV       240
     RDAYLGEDA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page