(data stored in ACNUC7421 zone)

EMBL: CP000489.PE182

CP000489.PE182       Location/Qualifiers
FT   CDS             complement(165932..167233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0183"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpa:BPP2721 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68299"
FT                   /db_xref="GOA:A1AYF5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF5"
FT                   /protein_id="ABL68299.1"
FT                   /translation="MQNIAVIGAGITGVTTAYELAARGFAVTVYDRNRYAAMETSFANG
FT                   GQLSASNAEVWNYPATIAKGLTWLMKPDAPLSLSLKPGWHKYSWLAQFLGNIPNYRANT
FT                   TRTAELAVAARQRMRDIAAREGIAFDRDDRGILHFYATEAQMAHARRVSELLAAGGVER
FT                   VELDAEGIRRLEPRLKGDFIGGFHTPGDATGDIHLFTTGLARASARLGVTYRMETEILS
FT                   CRHDGTDTHIRYRDAEGQVRHAIHPAIVVCAGIGSRAIARGLGDRVNIYPVKGYSITVN
FT                   LEDDISVQAAPELSLLDDAAKIVTSRLGRARFRVAGTAEFAGENRDIRACRIRPLVEWV
FT                   NRHFPAVSTRQCVPWAGLRPMTPSMMPKVGPGRRAGVFYNTGHGHLGWTLSAATADLVA
FT                   QSVEAQLRRPGAVMPLTAENMPPARAALVGASDR"
     MQNIAVIGAG ITGVTTAYEL AARGFAVTVY DRNRYAAMET SFANGGQLSA SNAEVWNYPA        60
     TIAKGLTWLM KPDAPLSLSL KPGWHKYSWL AQFLGNIPNY RANTTRTAEL AVAARQRMRD       120
     IAAREGIAFD RDDRGILHFY ATEAQMAHAR RVSELLAAGG VERVELDAEG IRRLEPRLKG       180
     DFIGGFHTPG DATGDIHLFT TGLARASARL GVTYRMETEI LSCRHDGTDT HIRYRDAEGQ       240
     VRHAIHPAIV VCAGIGSRAI ARGLGDRVNI YPVKGYSITV NLEDDISVQA APELSLLDDA       300
     AKIVTSRLGR ARFRVAGTAE FAGENRDIRA CRIRPLVEWV NRHFPAVSTR QCVPWAGLRP       360
     MTPSMMPKVG PGRRAGVFYN TGHGHLGWTL SAATADLVAQ SVEAQLRRPG AVMPLTAENM       420
     PPARAALVGA SDR                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page