(data stored in ACNUC7421 zone)

EMBL: CP000489.PE183

CP000489.PE183       Location/Qualifiers
FT   CDS             complement(167506..168204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68300"
FT                   /db_xref="GOA:A1AYF6"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF6"
FT                   /protein_id="ABL68300.1"
FT                   /translation="MTDQTMEGFYKSRFIPRAHRIGRLSLLIAMVLCMMPALYLSFVLD
FT                   AFPGIGPILTGFLAIAAFVGIIWVVEPISYFPVLGVCGTYMSFLSGNIGNMRMPVVISC
FT                   QSAVEAEAGSRKAEVAAVIGIAVSVLVNLVFLVALVLIGAALIEVLPPAVAEAIKSYTL
FT                   PALYGAVLVMFMNSATRRNALTGILAGLAVFLSPIPSLFGSAAAGILAIIVAVALNWGK
FT                   RTPEAGKNPA"
     MTDQTMEGFY KSRFIPRAHR IGRLSLLIAM VLCMMPALYL SFVLDAFPGI GPILTGFLAI        60
     AAFVGIIWVV EPISYFPVLG VCGTYMSFLS GNIGNMRMPV VISCQSAVEA EAGSRKAEVA       120
     AVIGIAVSVL VNLVFLVALV LIGAALIEVL PPAVAEAIKS YTLPALYGAV LVMFMNSATR       180
     RNALTGILAG LAVFLSPIPS LFGSAAAGIL AIIVAVALNW GKRTPEAGKN PA               232
//

If you have problems or comments...

PBIL Back to PBIL home page