(data stored in ACNUC7421 zone)

EMBL: CP000489.PE184

CP000489.PE184       Location/Qualifiers
FT   CDS             complement(168231..168968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68301"
FT                   /db_xref="GOA:A1AYF7"
FT                   /db_xref="InterPro:IPR032479"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF7"
FT                   /protein_id="ABL68301.1"
FT                   /translation="MENVLQIANGPVLWLFAILVISVVVAQALMYLRMTLIFSNRYEIL
FT                   TPEERTRIYKTAAINSIGPAVAIFFVAVSLVAMVGSPVTLMRVGVIGSAVFEFVAADQG
FT                   ARAVGAELGRDSYTLQAFAASVWVMTLGGMGWLLSTFFLTKGLDRTQDRMALSNPALIR
FT                   AVGTATPIAIFFLLGANAAVSKSWLSNITIAADNLAAVVTSAGCMVALHAAGKHRPWLR
FT                   EWAVGLSLIAGIAVGFGVGRILA"
     MENVLQIANG PVLWLFAILV ISVVVAQALM YLRMTLIFSN RYEILTPEER TRIYKTAAIN        60
     SIGPAVAIFF VAVSLVAMVG SPVTLMRVGV IGSAVFEFVA ADQGARAVGA ELGRDSYTLQ       120
     AFAASVWVMT LGGMGWLLST FFLTKGLDRT QDRMALSNPA LIRAVGTATP IAIFFLLGAN       180
     AAVSKSWLSN ITIAADNLAA VVTSAGCMVA LHAAGKHRPW LREWAVGLSL IAGIAVGFGV       240
     GRILA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page