(data stored in ACNUC7421 zone)

EMBL: CP000489.PE186

CP000489.PE186       Location/Qualifiers
FT   CDS             170313..170816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0187"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: sil:SPO1261
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68303"
FT                   /db_xref="GOA:A1AYF9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF9"
FT                   /protein_id="ABL68303.1"
FT                   /translation="MLRNWSKAFRQGNAVYQLNMLANATIRSFEDGFVEIVGLDIRTIR
FT                   VLRLIGDNPGITFAEIAVLGALERSLASRLIQTLVRQDLVERRNDPNDARRFGLHITPI
FT                   GQETRRRADMLSDLGLEILFQKLDPAEAAAFVRTLGKLADWIDSDEFERKIRQTYADAS
FT                   ERLK"
     MLRNWSKAFR QGNAVYQLNM LANATIRSFE DGFVEIVGLD IRTIRVLRLI GDNPGITFAE        60
     IAVLGALERS LASRLIQTLV RQDLVERRND PNDARRFGLH ITPIGQETRR RADMLSDLGL       120
     EILFQKLDPA EAAAFVRTLG KLADWIDSDE FERKIRQTYA DASERLK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page