(data stored in ACNUC7421 zone)

EMBL: CP000489.PE188

CP000489.PE188       Location/Qualifiers
FT   CDS             complement(171675..173552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0189"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rpe:RPE_1982 TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68305"
FT                   /db_xref="GOA:A1AYG1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG1"
FT                   /protein_id="ABL68305.1"
FT                   /translation="MFELLASNLAPIMFLSLIGILLLGYPVAFSLAANGLLFFFVAVEL
FT                   SPYAPGTIALSWNLLVALPDRVFSIMSNEVLLAVPFFTFMGIVLQRSGMAEDLLETFGQ
FT                   FFGSVRGGVAYAVVFVGTLLAATTGVVAASVIAMGMISLPVMMRYGYDRRVASGTIMAS
FT                   GTLAQILPPSTILIVLADQLGTSVGDMYTVAFLPSLMLTLSFMLFILLVSIFRPSYVPA
FT                   LPPEALLYREPNGTRGVWQVLALFVVSGIIASLTVRASGMEKTIDVVIFTLCGLSIAAL
FT                   VIALMSRLLGRAALVAGGVLALGFAALAMTRDAGSLAATLAWAASAVCAYVALHGASAR
FT                   GARTRLISAIAERVAFVLVPPVLLIFLVLGTIFIGLATPVEAGAMGAVGSVVLALAKRL
FT                   ADRRPDRLNLAMMTQATYSTAKLCAFILFILIGARVFALTFFGINGHLWVEHLLTGLPG
FT                   GQRGFMIFTVVVIFVLGCFLDFFEIAFIAIPLLLVPAITLGVDPLWLGLVIAITLQTSF
FT                   LTPPLGFSLFFLRSIAPKAAYKDEISGKMIDGVSTRQIYLGGIPFVIIQLLLVIVVLFA
FT                   PEIFMGVGGQAPVMDMEDAMRTLEGFTIDIDPTGGIAVPQIDLTFPSGN"
     MFELLASNLA PIMFLSLIGI LLLGYPVAFS LAANGLLFFF VAVELSPYAP GTIALSWNLL        60
     VALPDRVFSI MSNEVLLAVP FFTFMGIVLQ RSGMAEDLLE TFGQFFGSVR GGVAYAVVFV       120
     GTLLAATTGV VAASVIAMGM ISLPVMMRYG YDRRVASGTI MASGTLAQIL PPSTILIVLA       180
     DQLGTSVGDM YTVAFLPSLM LTLSFMLFIL LVSIFRPSYV PALPPEALLY REPNGTRGVW       240
     QVLALFVVSG IIASLTVRAS GMEKTIDVVI FTLCGLSIAA LVIALMSRLL GRAALVAGGV       300
     LALGFAALAM TRDAGSLAAT LAWAASAVCA YVALHGASAR GARTRLISAI AERVAFVLVP       360
     PVLLIFLVLG TIFIGLATPV EAGAMGAVGS VVLALAKRLA DRRPDRLNLA MMTQATYSTA       420
     KLCAFILFIL IGARVFALTF FGINGHLWVE HLLTGLPGGQ RGFMIFTVVV IFVLGCFLDF       480
     FEIAFIAIPL LLVPAITLGV DPLWLGLVIA ITLQTSFLTP PLGFSLFFLR SIAPKAAYKD       540
     EISGKMIDGV STRQIYLGGI PFVIIQLLLV IVVLFAPEIF MGVGGQAPVM DMEDAMRTLE       600
     GFTIDIDPTG GIAVPQIDLT FPSGN                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page