(data stored in ACNUC7421 zone)

EMBL: CP000489.PE189

CP000489.PE189       Location/Qualifiers
FT   CDS             complement(173552..174082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0190"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: mlo:mll5171 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68306"
FT                   /db_xref="GOA:A1AYG2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG2"
FT                   /protein_id="ABL68306.1"
FT                   /translation="MTNFLLRSSRAIDYLNRGIGKAASWAIVMAILVSALNALSRHLFG
FT                   VTSNAWLELQWYLFGAVFMLCAAWAMQDNEHVRIDVFSSRFSPRTREIVEMAGHLLFLF
FT                   PFVALMLWLSMQFFLKTLASGEMSPNQGGLPLWPAKALIFIGFLQLTLQWLSEVIKTGF
FT                   RLRDLPNTEGEVS"
     MTNFLLRSSR AIDYLNRGIG KAASWAIVMA ILVSALNALS RHLFGVTSNA WLELQWYLFG        60
     AVFMLCAAWA MQDNEHVRID VFSSRFSPRT REIVEMAGHL LFLFPFVALM LWLSMQFFLK       120
     TLASGEMSPN QGGLPLWPAK ALIFIGFLQL TLQWLSEVIK TGFRLRDLPN TEGEVS           176
//

If you have problems or comments...

PBIL Back to PBIL home page