(data stored in ACNUC7421 zone)

EMBL: CP000489.PE193

CP000489.PE193       Location/Qualifiers
FT   CDS             176899..177723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68310"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG6"
FT                   /protein_id="ABL68310.1"
FT                   /translation="MTMERDSAPLIRIDSCALASARRVAAMLDCDPGMVADGQPLPRGW
FT                   HFILLGGDTRRSELRGDGFPGLGVPMPDFGLPRLLLAGRSVRWDGDIAIGEPVERDSRI
FT                   EDITEKQGPAGRMALVRLRHALRPLSQAQAAVIETQTYALLPAGPSAPRPAAPAGAEAA
FT                   HRRRVTPDETLLFQYSALGFNSHKIHLDRDHARIVEGLPDLVVNGGLVALLATEFLRTD
FT                   LGVTPTALRARHLSPLYCNHPMTLCADPAPSGWRIRVLDDSGVLAAELEVEA"
     MTMERDSAPL IRIDSCALAS ARRVAAMLDC DPGMVADGQP LPRGWHFILL GGDTRRSELR        60
     GDGFPGLGVP MPDFGLPRLL LAGRSVRWDG DIAIGEPVER DSRIEDITEK QGPAGRMALV       120
     RLRHALRPLS QAQAAVIETQ TYALLPAGPS APRPAAPAGA EAAHRRRVTP DETLLFQYSA       180
     LGFNSHKIHL DRDHARIVEG LPDLVVNGGL VALLATEFLR TDLGVTPTAL RARHLSPLYC       240
     NHPMTLCADP APSGWRIRVL DDSGVLAAEL EVEA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page