(data stored in ACNUC7421 zone)

EMBL: CP000489.PE194

CP000489.PE194       Location/Qualifiers
FT   CDS             177720..178925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0195"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rpa:RPA4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68311"
FT                   /db_xref="GOA:A1AYG7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG7"
FT                   /protein_id="ABL68311.1"
FT                   /translation="MSFQPLKSIRVLDLTSVVVGPAATWRLGQYGADVVKVENPAGDLM
FT                   RGLGGQSPTGQHSGAYLHLNRGKRNICLDLKSDGARQVIARLIAQADVVVANMRPKALE
FT                   KLGIDPARIQARHPDKIYCLLTGFGTDGPYGGFPAYDSVVQAAAGIPGLSLARDGVPRY
FT                   VPLLICDHVVGEIAAGAILAAVIERQATGRGRMIEIPMFETMAAFVLQEHLAQHSFDPP
FT                   VGPPGDRRLLSPHNMPVQTADGHVAVTINTDAQVRAFLQVTDRAELADDPRFATVAARA
FT                   DNVAEWFEVRGAPLTQRTTAEWLSLFRAADLAAMPCHTLETLPSDPHLAAVGLIEHEDH
FT                   PTEGRTAVIRASLRVDGDSVPTRSPAAPRGWDTRDVLADAGFSASEIETLLSEGSAHEH
FT                   HR"
     MSFQPLKSIR VLDLTSVVVG PAATWRLGQY GADVVKVENP AGDLMRGLGG QSPTGQHSGA        60
     YLHLNRGKRN ICLDLKSDGA RQVIARLIAQ ADVVVANMRP KALEKLGIDP ARIQARHPDK       120
     IYCLLTGFGT DGPYGGFPAY DSVVQAAAGI PGLSLARDGV PRYVPLLICD HVVGEIAAGA       180
     ILAAVIERQA TGRGRMIEIP MFETMAAFVL QEHLAQHSFD PPVGPPGDRR LLSPHNMPVQ       240
     TADGHVAVTI NTDAQVRAFL QVTDRAELAD DPRFATVAAR ADNVAEWFEV RGAPLTQRTT       300
     AEWLSLFRAA DLAAMPCHTL ETLPSDPHLA AVGLIEHEDH PTEGRTAVIR ASLRVDGDSV       360
     PTRSPAAPRG WDTRDVLADA GFSASEIETL LSEGSAHEHH R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page