(data stored in ACNUC7421 zone)

EMBL: CP000489.PE195

CP000489.PE195       Location/Qualifiers
FT   CDS             178909..179730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   psp:PSPPH_1258 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68312"
FT                   /db_xref="GOA:A1AYG8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG8"
FT                   /protein_id="ABL68312.1"
FT                   /translation="MNITAETVPAALKGGPRYLDGKVCVIVGVASLRGIGYATAELFAR
FT                   HGAKLVVVDLMMDDTIAADVSQAIATRNGEAPELLGLRCDIGRAADCQGVIDQAVARFG
FT                   RIDCLVNTAAIVKSDGLLAISGDDLDLILNVNLKGAFNLCQNALRVFEEQGSGTIVNIA
FT                   SVAAQRGGGLVGGAHYAASKGGVISLTRSIAREFGPKGIRANAICPSMTETGMLDGNVT
FT                   EAQFAQIVDAIPLKRAGRPEDIANACLYLASDLSAYVTGTTLDVNGGSHIH"
     MNITAETVPA ALKGGPRYLD GKVCVIVGVA SLRGIGYATA ELFARHGAKL VVVDLMMDDT        60
     IAADVSQAIA TRNGEAPELL GLRCDIGRAA DCQGVIDQAV ARFGRIDCLV NTAAIVKSDG       120
     LLAISGDDLD LILNVNLKGA FNLCQNALRV FEEQGSGTIV NIASVAAQRG GGLVGGAHYA       180
     ASKGGVISLT RSIAREFGPK GIRANAICPS MTETGMLDGN VTEAQFAQIV DAIPLKRAGR       240
     PEDIANACLY LASDLSAYVT GTTLDVNGGS HIH                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page