(data stored in ACNUC7421 zone)

EMBL: CP000489.PE198

CP000489.PE198       Location/Qualifiers
FT   CDS             complement(183912..185984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0201"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   jan:Jann_0676 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68315"
FT                   /db_xref="GOA:A1AYH1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH1"
FT                   /protein_id="ABL68315.1"
FT                   /translation="MPVHYDLAGDSAVLTFDNPPLNVLGQAMRADLARAIAQAAADRPA
FT                   RLILRGAGRNFVAGADAREFDGPPLDPQLNEVLDALAALPFPTIAAIHGAALGGGLEIA
FT                   LACRFRIAHPSATLGLPEVTLGIVPGAGGTQRLPRLVGMAAALDLLGQGRSVTAAEAES
FT                   LGLIDLIADDPMAAARGVDTQTLLRALCADDRPPPAPDEAAVAAAHARADRRAPGQVAP
FT                   HRAIELVATSAQEPIKAALTRERATFLDLRGSDQARALRHVFFAERAAMAQGKAWPAPA
FT                   PEIARAVVVGGGNMGAAIAYALLSAGLVVRVVETDAAALDRARDNIAGLVAQGRKRGAL
FT                   TDAGAAELQARLSLAVGYDDLPAADLAIEAAYEDMAVKQAIFAALQDALPDSTILATNT
FT                   SYLDIDLLAQGIRQPGRFLGLHFFAPAHVMKLLEIVRGEATSDQTLGAAFRLARKLGKV
FT                   PVLAGVCDGFIGNRILARYRHAADILLLEGALPAQVDAAMRGFGMAMGPYEAQDMSGLD
FT                   IAYANRRRQNLRDRADHRYVPIADHLVERCRRLGRKSGAGWYDYDAEGRAQPSDEVTQA
FT                   ILSASRDAGITRVALPAEGIAERLVLAMIAEATRILAEGIAAAPRDIDLVLVHGYGFPR
FT                   WRGGLMHHADRLTPARILSRIEALAKDDPLSWSVPPLLRQLADEGRDFTSLNPSA"
     MPVHYDLAGD SAVLTFDNPP LNVLGQAMRA DLARAIAQAA ADRPARLILR GAGRNFVAGA        60
     DAREFDGPPL DPQLNEVLDA LAALPFPTIA AIHGAALGGG LEIALACRFR IAHPSATLGL       120
     PEVTLGIVPG AGGTQRLPRL VGMAAALDLL GQGRSVTAAE AESLGLIDLI ADDPMAAARG       180
     VDTQTLLRAL CADDRPPPAP DEAAVAAAHA RADRRAPGQV APHRAIELVA TSAQEPIKAA       240
     LTRERATFLD LRGSDQARAL RHVFFAERAA MAQGKAWPAP APEIARAVVV GGGNMGAAIA       300
     YALLSAGLVV RVVETDAAAL DRARDNIAGL VAQGRKRGAL TDAGAAELQA RLSLAVGYDD       360
     LPAADLAIEA AYEDMAVKQA IFAALQDALP DSTILATNTS YLDIDLLAQG IRQPGRFLGL       420
     HFFAPAHVMK LLEIVRGEAT SDQTLGAAFR LARKLGKVPV LAGVCDGFIG NRILARYRHA       480
     ADILLLEGAL PAQVDAAMRG FGMAMGPYEA QDMSGLDIAY ANRRRQNLRD RADHRYVPIA       540
     DHLVERCRRL GRKSGAGWYD YDAEGRAQPS DEVTQAILSA SRDAGITRVA LPAEGIAERL       600
     VLAMIAEATR ILAEGIAAAP RDIDLVLVHG YGFPRWRGGL MHHADRLTPA RILSRIEALA       660
     KDDPLSWSVP PLLRQLADEG RDFTSLNPSA                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page