(data stored in ACNUC7421 zone)

EMBL: CP000489.PE2

CP000489.PE2         Location/Qualifiers
FT   CDS             709..2013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0002"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: rsp:RSP_1231 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68119"
FT                   /db_xref="GOA:A1AXX5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXX5"
FT                   /protein_id="ABL68119.1"
FT                   /translation="MRRIVRAHRLDMTEERLNLSDLKAKSPADLLAMAEEWEIENASTM
FT                   RKGEMMFSILKEHAEEGFEIGGDGVLEVVQDGFGFLRSPEANYLPGPDDIYVSPDMIRQ
FT                   HSLRTGDTVEGVIRAPGENERYFALTKVEKINFENPEKARHKVAFDNLTPLYPNERLKM
FT                   EIEDPTIKDRSARIIDLVAPIGKGQRSLIVAPPRTGKTVLLQNIAHSIEKNHPECYLIV
FT                   LLIDERPEEVTDMQRSVKGEVISSTFDEPASRHVAVSEMVIEKAKRLVEHKRDVVILLD
FT                   SITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTG
FT                   SRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDILKSGTRKEELLVDAKDLQKTYLL
FT                   RRILNPMGTTDAIEFLISKLKQTKTNGEFFDSMNA"
     MRRIVRAHRL DMTEERLNLS DLKAKSPADL LAMAEEWEIE NASTMRKGEM MFSILKEHAE        60
     EGFEIGGDGV LEVVQDGFGF LRSPEANYLP GPDDIYVSPD MIRQHSLRTG DTVEGVIRAP       120
     GENERYFALT KVEKINFENP EKARHKVAFD NLTPLYPNER LKMEIEDPTI KDRSARIIDL       180
     VAPIGKGQRS LIVAPPRTGK TVLLQNIAHS IEKNHPECYL IVLLIDERPE EVTDMQRSVK       240
     GEVISSTFDE PASRHVAVSE MVIEKAKRLV EHKRDVVILL DSITRLGRAF NTVVPSSGKV       300
     LTGGVDANAL QRPKRFFGAA RNIEEGGSLT IIATALIDTG SRMDEVIFEE FKGTGNSEIV       360
     LDRKVADKRV FPAMDILKSG TRKEELLVDA KDLQKTYLLR RILNPMGTTD AIEFLISKLK       420
     QTKTNGEFFD SMNA                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page