(data stored in ACNUC7421 zone)

EMBL: CP000489.PE20

CP000489.PE20        Location/Qualifiers
FT   CDS             16615..18417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0020"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: rsp:RSP_2578
FT                   putative pqq dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68137"
FT                   /db_xref="GOA:A1AXZ3"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ3"
FT                   /protein_id="ABL68137.1"
FT                   /translation="MKNLMNGACLALLMSGTAALANDSVLAEIAKPQQWAIQMGDYANT
FT                   RYSTLDQINKDNVKDLRVAWTFSTGVLRGHEGSPLVIGDVMYVHTPFPNRVFALDLNDN
FT                   GKILWRYEPQQDPNVIAVMCCDTVYRGLSYADGMILLGQADTTVVALDATSGEVKWSTK
FT                   IGDPGIGETLTATVVPVKDKVLVGISGGEYGVRGRMTALNLTDGSEAWKAWSTGPDEEL
FT                   LVDPETTTHLGKPIGADSSLNSWEGDQWQIGGGTIWGWFSYDPDLNLVYYGTGNPSTWN
FT                   PSQRPGDNKWSMTIMARDADTGMAKWFYQMTPHDEWDYDGVNEMILTNQTVDGQERKLL
FT                   THFDRNGLAYTMDRETGELLVAEKYDPVVNWTTGVDMDPNSETYGRPAVVAEYSTAQNG
FT                   EDENTTGVCPAALGTKDQQPAAFSPKTNLFYVPTNHVCMDYEPFRVAYTAGQPYVGATL
FT                   SMYPAPNSHGGMGNFIAWDNTTGEIKWSVPEQFSVWSGALATAGDVVFYGTLEGYLKAV
FT                   DAQTGEELYKFKTPSGIIGNVMTYEHGGKQYVGILSGVGGWAGIGLAAGLTNPNDGLGA
FT                   VGGYASLSQYTELGGQLTVFELPG"
     MKNLMNGACL ALLMSGTAAL ANDSVLAEIA KPQQWAIQMG DYANTRYSTL DQINKDNVKD        60
     LRVAWTFSTG VLRGHEGSPL VIGDVMYVHT PFPNRVFALD LNDNGKILWR YEPQQDPNVI       120
     AVMCCDTVYR GLSYADGMIL LGQADTTVVA LDATSGEVKW STKIGDPGIG ETLTATVVPV       180
     KDKVLVGISG GEYGVRGRMT ALNLTDGSEA WKAWSTGPDE ELLVDPETTT HLGKPIGADS       240
     SLNSWEGDQW QIGGGTIWGW FSYDPDLNLV YYGTGNPSTW NPSQRPGDNK WSMTIMARDA       300
     DTGMAKWFYQ MTPHDEWDYD GVNEMILTNQ TVDGQERKLL THFDRNGLAY TMDRETGELL       360
     VAEKYDPVVN WTTGVDMDPN SETYGRPAVV AEYSTAQNGE DENTTGVCPA ALGTKDQQPA       420
     AFSPKTNLFY VPTNHVCMDY EPFRVAYTAG QPYVGATLSM YPAPNSHGGM GNFIAWDNTT       480
     GEIKWSVPEQ FSVWSGALAT AGDVVFYGTL EGYLKAVDAQ TGEELYKFKT PSGIIGNVMT       540
     YEHGGKQYVG ILSGVGGWAG IGLAAGLTNP NDGLGAVGGY ASLSQYTELG GQLTVFELPG       600
//

If you have problems or comments...

PBIL Back to PBIL home page