(data stored in ACNUC7421 zone)

EMBL: CP000489.PE200

CP000489.PE200       Location/Qualifiers
FT   CDS             186916..188004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0203"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: jan:Jann_2939
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68317"
FT                   /db_xref="GOA:A1AYH3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH3"
FT                   /protein_id="ABL68317.1"
FT                   /translation="MELGLFHMPLHPAERPLVDVLAENTEKIVYADKLGFAEAWVGEHY
FT                   SATTEPITSPLIFLASLLPQTKQIRLGTGVLCLPNHHPAQLAGQVALFDHMAQGRFMMG
FT                   VGPGGLASDMELFDVLDANVRNEKFVEAIKIIKQIWSQDPPYDIQGKYWQIKITDNIIP
FT                   ELGVGYMQKPFTKPHPPISLSSMSPDSESVSRAVKLGWKPISANFAPESTIIGHWKKYV
FT                   EGCEAAGREPTGQDWSVARNVLIADSDAQAEDWLLDPKGSNYYYFDYLWKVLKVADYTA
FT                   VIKPDINMADEDVTVEAIVKASVLYGSRKTVTDKIMSLRERSGPFGTLLMAAMDGSGKN
FT                   RERERLTMRRLAEDVLPVVNAA"
     MELGLFHMPL HPAERPLVDV LAENTEKIVY ADKLGFAEAW VGEHYSATTE PITSPLIFLA        60
     SLLPQTKQIR LGTGVLCLPN HHPAQLAGQV ALFDHMAQGR FMMGVGPGGL ASDMELFDVL       120
     DANVRNEKFV EAIKIIKQIW SQDPPYDIQG KYWQIKITDN IIPELGVGYM QKPFTKPHPP       180
     ISLSSMSPDS ESVSRAVKLG WKPISANFAP ESTIIGHWKK YVEGCEAAGR EPTGQDWSVA       240
     RNVLIADSDA QAEDWLLDPK GSNYYYFDYL WKVLKVADYT AVIKPDINMA DEDVTVEAIV       300
     KASVLYGSRK TVTDKIMSLR ERSGPFGTLL MAAMDGSGKN RERERLTMRR LAEDVLPVVN       360
     AA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page