(data stored in ACNUC7421 zone)

EMBL: CP000489.PE204

CP000489.PE204       Location/Qualifiers
FT   CDS             complement(190129..191124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0207"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RS05450
FT                   putative hydrolase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68321"
FT                   /db_xref="GOA:A1AYH7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH7"
FT                   /protein_id="ABL68321.1"
FT                   /translation="MTPILRGLSVLALALAPIGVGAEPATSVLKRDFAFPEPVEGMPAR
FT                   LSEFPDLQINAFTTNDGVSISYWEAGSGEPVLFVPAWGSNGAELIDVIWLLSRTHHVYV
FT                   MDPRNQGLSERTAKGQRIARHAMDLNQLLDHLELDRTVLAGWSMGAAVIWAYVDLFGTD
FT                   HITRAVFVDQPVSIYTHADWTEEERLNAGGMTTSPERMIAAFAGAPTNQQVVDMKVTHR
FT                   ARMLDTPHIRNATSFAQAVIPSDPDHAALVLFDHATNDWRDVISHKLDMPVAVFSGEES
FT                   NNLPSQAWIARTVPDGRLYSYTAEQQGDHMLMLKNPVGFVSDLRAFLAGE"
     MTPILRGLSV LALALAPIGV GAEPATSVLK RDFAFPEPVE GMPARLSEFP DLQINAFTTN        60
     DGVSISYWEA GSGEPVLFVP AWGSNGAELI DVIWLLSRTH HVYVMDPRNQ GLSERTAKGQ       120
     RIARHAMDLN QLLDHLELDR TVLAGWSMGA AVIWAYVDLF GTDHITRAVF VDQPVSIYTH       180
     ADWTEEERLN AGGMTTSPER MIAAFAGAPT NQQVVDMKVT HRARMLDTPH IRNATSFAQA       240
     VIPSDPDHAA LVLFDHATND WRDVISHKLD MPVAVFSGEE SNNLPSQAWI ARTVPDGRLY       300
     SYTAEQQGDH MLMLKNPVGF VSDLRAFLAG E                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page