(data stored in ACNUC7421 zone)

EMBL: CP000489.PE206

CP000489.PE206       Location/Qualifiers
FT   CDS             191454..192362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0209"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: psb:Psyr_2945 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68323"
FT                   /db_xref="GOA:A1AYH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH9"
FT                   /protein_id="ABL68323.1"
FT                   /translation="MMPASHLSGVHAFVETAHHLSFTGAAESLGMTKSAVGKSVSRLEA
FT                   RLGVKLIHRSTRRLVLTQDGEAYLAAARRALEEIEAAEASLSSNHREIAGRLRIDAPAA
FT                   WGRRVLLPILTEVALAQPGLRLSLSLTDRIIDPVAEQVDLVIRFGETADTADLISRKLA
FT                   EQRAPLVAAPAYLARCGVPAQPEDLLRHCCVTGISREMPIGFRIARPGCAPQRLRVAPA
FT                   HEIGDGSAVVEAAIAGLGIAQMPLSLVADALSDGRLVEVLPEFGTVPVGIFALWPRTRH
FT                   LLARVRHVVDLLAAKGQAGAL"
     MMPASHLSGV HAFVETAHHL SFTGAAESLG MTKSAVGKSV SRLEARLGVK LIHRSTRRLV        60
     LTQDGEAYLA AARRALEEIE AAEASLSSNH REIAGRLRID APAAWGRRVL LPILTEVALA       120
     QPGLRLSLSL TDRIIDPVAE QVDLVIRFGE TADTADLISR KLAEQRAPLV AAPAYLARCG       180
     VPAQPEDLLR HCCVTGISRE MPIGFRIARP GCAPQRLRVA PAHEIGDGSA VVEAAIAGLG       240
     IAQMPLSLVA DALSDGRLVE VLPEFGTVPV GIFALWPRTR HLLARVRHVV DLLAAKGQAG       300
     AL                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page