(data stored in ACNUC7421 zone)

EMBL: CP000489.PE213

CP000489.PE213       Location/Qualifiers
FT   CDS             complement(198147..198683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0216"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: nwi:Nwi_3124 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68330"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI6"
FT                   /protein_id="ABL68330.1"
FT                   /translation="MPDRSRRLFNVLFLCTGNSARSIIAESVLRQDGGGRFRAFSAGSR
FT                   PRGEVHPTARGVLENFHYPTEGLRSKSWDEFAGADAPVMDFVFTVCDQAAGETCPLWPR
FT                   QPISAHWGVPDPAAATGTGLEREMAFIDTLRIMRNRISVFTALPMATLNRASLTARLHQ
FT                   IGQSQGATSARTDMA"
     MPDRSRRLFN VLFLCTGNSA RSIIAESVLR QDGGGRFRAF SAGSRPRGEV HPTARGVLEN        60
     FHYPTEGLRS KSWDEFAGAD APVMDFVFTV CDQAAGETCP LWPRQPISAH WGVPDPAAAT       120
     GTGLEREMAF IDTLRIMRNR ISVFTALPMA TLNRASLTAR LHQIGQSQGA TSARTDMA         178
//

If you have problems or comments...

PBIL Back to PBIL home page