(data stored in ACNUC7421 zone)

EMBL: CP000489.PE22

CP000489.PE22        Location/Qualifiers
FT   CDS             19196..20008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0022"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: rsp:RSP_2580 putative methanol oxidation protein;
FT                   TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68139"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ5"
FT                   /protein_id="ABL68139.1"
FT                   /translation="MRRALTLAVLATCAVLPALAQVADLRSKTEFRVCADPAAVPMSSQ
FT                   DGKGFENRIAQLFAEKLGVPVAYTWFPQGPGFIRKTLRAGLCDVVIGYAQGDEMVQNTN
FT                   HYYTSAYGIVTRNDSPLASVEALDDPALGGHPIGVVAGTPPASNLARAGLAKNMRGWDL
FT                   FVDRRVEDPVGDMLAQVKSGELAAAVIWGPLAGPLVKQDPELQFTPLLKESGGPRMFYR
FT                   ITMGVRLGEQEWKRELNSLIRRHQDEIDAILRDAGVPLLDDYGKALKQ"
     MRRALTLAVL ATCAVLPALA QVADLRSKTE FRVCADPAAV PMSSQDGKGF ENRIAQLFAE        60
     KLGVPVAYTW FPQGPGFIRK TLRAGLCDVV IGYAQGDEMV QNTNHYYTSA YGIVTRNDSP       120
     LASVEALDDP ALGGHPIGVV AGTPPASNLA RAGLAKNMRG WDLFVDRRVE DPVGDMLAQV       180
     KSGELAAAVI WGPLAGPLVK QDPELQFTPL LKESGGPRMF YRITMGVRLG EQEWKRELNS       240
     LIRRHQDEID AILRDAGVPL LDDYGKALKQ                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page